PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00024973-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family WOX
Protein Properties Length: 197aa    MW: 22606.5 Da    PI: 9.4506
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00024973-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.47.6e-211776357
                           --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                           +R+++tkeq++ Le+l+++  r+p+a+++++++++l    +++ ++V++WFqN++a++++
  SMil_00024973-RA_Salv 17 SRWNPTKEQINMLESLYRQgLRTPTADQIQHITARLrdygHIEGKNVFYWFQNHKARQRQ 76
                           6*****************99**************************************97 PP

2Wus_type_Homeobox116.61.2e-371778465
      Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                           +RW+Pt+eQi++Le+ly++GlrtP++++iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqkq
  SMil_00024973-RA_Salv 17 SRWNPTKEQINMLESLYRQGLRTPTADQIQHITARLRDYGHIEGKNVFYWFQNHKARQRQKQ 78
                           8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-131284IPR009057Homeodomain-like
PROSITE profilePS5007110.4791277IPR001356Homeobox domain
SMARTSM003891.9E-41481IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-81776IPR009057Homeodomain-like
PfamPF000462.0E-181776IPR001356Homeobox domain
CDDcd000862.52E-51878No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
LLITIEGGDQ NPANGGSRWN PTKEQINMLE SLYRQGLRTP TADQIQHITA RLRDYGHIEG  60
KNVFYWFQNH KARQRQKQKQ ETFAFYNRFL HSPPPLFPPP PPFHNVICSP CYIPPPKKVQ  120
LPTALGSVKR CRTIPQTIDS SHLTLTQRYN TTESREHLNS SSHDQETLDL FPIHPTGILQ  180
STSNHDQKNP SFCADKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077272.12e-72PREDICTED: WUSCHEL-related homeobox 2
SwissprotQ6X7K11e-44WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A022RL462e-61A0A022RL46_ERYGU; Uncharacterized protein
STRINGGLYMA11G14940.26e-60(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-41WUSCHEL related homeobox 2